Существует ли патент на сочетание нанокоронавирусной вакцины с оксидом графена в качестве носителя?


Изобретение относится к области наноматериалов и биомедицины и касается вакцины, в частности к разработке ядерной рекомбинантной нановакцины коронавируса 2019-nCoV. Изобретение также включает в себя способ приготовления вакцины и применение вакцины в экспериментах на животных.

Описание

Новая вакцина против коронавируса содержит оксид графена, карнозин, CpG и новый RBD коронавируса; связывание карнозина, CpG и RBD неокоронавируса на основе оксида графена; кодирующая последовательность CpG показана как SEQ ID NO 1; новый RBD коронавируса относится к новой области связывания рецептора белка коронавируса, которая может генерировать высокотитровое специфическое антитело, нацеленное на RBD в организме мыши, и обеспечивает сильную поддержку для профилактики и лечения нового коронавируса.

 

Техническая сфера

Изобретение относится к области наноматериалов и биомедицины и касается разработки платформы для создания вакцины. В частности, к разработке ядерной рекомбинантной нано-вакцины коронавируса 2019-nCoV. Изобретение также включает использование вакцины в испытаниях на животных.

Вакцина является совершенным оружием для устранения основных инфекционных заболеваний, имеет преимущества самой низкой стоимости и больше преимуществ перед другими методами лечения, несомненно, вселяет надежду в общественность, оспа уничтожается людьми посредством вакцинации, случаи полиомиелита сокращаются на 99 процентов, такие инфекционные заболевания, как дифтерия, становятся редкими, а уровень заболеваемости такими болезнями, как корь, столбняк новорожденных и тому подобное, значительно снижается.

Влияние вакцин на здоровье человека не бывает чрезмерным, и рождение каждой новой вакцины - это большая победа человека над инфекционным заболеванием! На сегодняшний день ни одно медицинское средство не способно оказать столь важное, длительное и глубокое воздействие на здоровье человека, как вакцина; не существует также ни одного лечебного средства, способного устранить болезнь с Земли при минимальной стоимости вакцины.

После возникновения эпидемии SARS-CoV-2 различные лаборатории Китая завершили выделение штаммов вируса, и для того, чтобы сделать большой шаг вперед в разработке вакцины, мы считаем, что скоро у нас будет окончательное оружие для искоренения SARS-CoV-2, однако, до сих пор нет утвержденной вакцины или препарата для лечения инфекции CoV, и существует большая необходимость в разработке эффективного препарата для лечения или профилактики коронавирусной инфекции и вспышки.

Согласно исследованиям вакцин против коронавирусов, таких как SARS и MERS, основной мишенью существующей вакцины против коронавируса является S-белок коронавируса. Вакцины должны вызывать не только гуморальный и клеточный иммунный ответ, но и мукозальный иммунный ответ, а также с помощью адъювантов вызывать сбалансированные Th1 и Th2 пути для создания действительно эффективных вакцин.

В настоящее время исследование большего количества вакцин против атипичной пневмонии и MERS в основном сосредоточено на вирусных векторных вакцинах и субъединичных вакцинах, и большое количество исследований показывает, что сложность атипичной пневмонии и MERS заключается в том, что невозможно стимулировать выработку В-клеток долгосрочной памяти, Клетки долговременной памяти у излеченных больных атипичной пневмонией и MERS могут существовать только в течение 2-3 лет, иммунологическая память не может быть сформирована, что приводит к неудаче в разработке вакцин, и в настоящее время только 6 потенциальных вакцин против коронавируса находятся на стадии клинических исследований, но ни одна эффективная вакцина не утверждена для продажи.

Раскрытие изобретения

Целью изобретения является создание рекомбинантной вакцины против коронавируса.

Другой целью изобретения является обеспечение способа приготовления вирусной рекомбинантной вакцины.

Еще одним объектом настоящего изобретения является использование рекомбинантной вакцины вируса.

Ввиду различных проблем обычных вакцин в настоящее время, как изменить проблемы существующих вакцин и усилить иммунный ответ является проблемой, которая всегда рассматривается, для того, чтобы улучшить иммунокомпетентность иммуногена и усилить способность иммунного ответа организма, наиболее основным методом является смешивание иммуногена с адъювантом, а иммунный адъювант является промотором, способным усилить иммунный ответ организма на иммуноген.

Олигодезоксинуклеотид CpG (ODN) - очень перспективный адъювант, открытый в последние годы. Было показано, что CpG ODN обладает лучшей адъювантной активностью in vivo, in vitro и в клинических исследованиях на животных, а лучшими исследованиями являются CpG7909 и CpG 1018. 11/9.2017 на рынке появилась вакцина против гепатита В, одобренная компанией Dynavax Technologies из Соединенных Штатов Америки FDA и использующая CpG1018 в качестве адъюванта, это первая одобренная вакцина с адъювантом CpG ODN в мире и используется для профилактики HBV-инфекции взрослых 18 лет и старше, и множество различных типов CpG ODN используются в качестве адъювантов во множестве клинических испытаний.

CpG в сочетании с TLR9 активирует незрелые клетки pDC и вызывает естественный и адаптивный иммунный ответ, но одиночная структура CpG имеет ограниченный эффект активации на иммунные клетки и легко быстро гидролизуется экзонуклеазой, поэтому стабильность CpG в естественных условиях недостаточна, а также возникают побочные эффекты; Олигодезоксинуклеотид CpG (ODN), синтезированный в последовательности, также может усилить эффект стимуляции, а после соединения CpG с другими белками, такими как антиген и т.п., олигодезоксинуклеотид CpG объединяется, так что олигодезоксинуклеотид CpG имеет очень очевидный эффект иммунной активации.

Графен - это двумерный углеродный наноматериал, состоящий из атомов углерода на sp-гибридизированных орбиталях в гексагональной сотовой решетке. Основной структурной единицей материала является наиболее стабильное бензольное шестичленное кольцо в органическом материале, и материал является самым идеальным двумерным материалом на сегодняшний день.

Оксид графена (GO) является производным оксида графена и представляет собой отшелушенный продукт. Благодаря характеристикам уникальной гибридизации SP2, совершенной двумерной структуре и высокой реактивности края, лечебная платформа на основе гибридной структуры может быть использована в качестве идеального носителя нагрузки и прививки при проектировании и разработке, и играет важную роль в аспектах систем доставки нанопрепаратов, биологического обнаружения, лечения опухолей, визуализации клеток и тому подобное.

Настоящее изобретение было завершено на основе вышеупомянутых исследований.

Изобретение раскрывает принципиально новый метод разработки вакцин, основанный на материале оксида графена, служащего каркасом для загрузки молекул CpG и рекомбинантных белков. На основе технической платформы готовится новая нано-новая коронная вакцина путем объединения рекомбинантного белка области RBD белка Spike вируса SAR-CoV-2. Приготовленная нано-новая коронная вакцина обладает более сильной иммуногенностью в экспериментах на мышах и может генерировать высокотитражные антитела.

В одном аспекте изобретение предоставляет вакцину против коронавируса, включающую оксид графена, карнозин, CpG и RBD. В предпочтительном варианте осуществления изобретения вакцина называется GO-Car-carnosine-CpG-RBD vaccine.

Оксид графена (GO) является оксидом графена, и после окисления кислородсодержащие функциональные группы на оксиде графена увеличиваются, так что оксид графена становится более активным, чем графен. Например, гидроксильные группы и эпоксидные группы беспорядочно распределены на монолите оксида графена, а карбоксильные группы и карбонильные группы введены на краю монолита. Обычные коммерческие продукты оксида графена выпускаются в виде порошка, хлопьев и растворов и имеют коричнево-желтый цвет.

Карнозин, известный под научным названием β-аланил-L-гистидин, представляет собой кристаллическое твердое вещество, состоящее из дипептида, состоящего из двух аминокислот, β-аланина и L-гистидина. Карнозин обладает сильной антиоксидантной способностью и может поглощать реактивные формы кислорода (ROS) и альфа-бета ненасыщенные альдегиды, которые образуются в результате переокисления жирных кислот в клеточных мембранах во время окислительного стресса.

Мотивы CpG обладают эффектом активации иммунной системы организма и могут быть использованы в качестве адъювантов. Предпочтительно, кодирующая последовательность CpG показана как SEQ ID NO 1.

RBD (spike receptor binding domain), конкретно белок коронавируса (S белок) Receptor Binding Domain (RBD) по настоящему изобретению. Например, белок RBD может быть выбран следующим образом:

PNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAP(SEQ ID NO 2)

Вакцина против коронавируса, раскрытая в данном изобретении, получена путем объединения карнозина, CpG и нового RBD коронавируса на активированном оксиде графена.

Дозировка GO в вакцине против коронавируса согласно изобретению используется в качестве каркасной основы, дозировка обычно чрезмерна, и дозировка карнозина может быть примерно в два раза больше, чем GO. CpG и новый коронавирусный RBD используются в качестве биологических макромолекул, и дозировка CpG и нового коронавирусного RBD меньше, и обычно составляет одну десятитысячную часть от GO в массовом соотношении. А RBD используется в количестве, более чем в 2 раза превышающем CpG, например, CpG: RBD = 1: 2-10, предпочтительно, дозировка RBD составляет 3-6 раз от CpG.

В другом аспекте настоящее изобретение обеспечивает способ приготовления вакцины против коронавируса, способ включает этапы:

получение CpG, рекомбинантного белка RBD и карнозина;

добавление сублимированного порошка GO в фосфатный буферный раствор и проведение ультразвуковой обработки;

добавление EDC и NHS для активации раствора GO, удаление избытка EDC/sulfo-NHS в реакционном растворе посредством ультрафильтрации, и регулировка pH реакционного раствора до нейтрального значения;

добавление карнозина, CpG и рекомбинантных белков RBD в реакционный раствор, инкубация с активированным GO;

избыток неконъюгированного белка удаляли из реакционного раствора и стерилизовали для использования.

Предпочтительно, продолжительность ультразвука составляет от 2 до 3 часов. Ультразвуковые условия составляли 200 Вт, 40 кГц.

Предпочтительно, фосфатный буфер имеет нейтральный pH, например, от 6,8 до 7,6, более предпочтительно от 7,0 до 7,4, или 7,2.

Предпочтительно, метод удаления избытка EDC/sulfo-NHS или неконъюгированного белка представляет собой ультрафильтрацию.

В предпочтительном варианте осуществления настоящего изобретения соотношение оксида графена, карнозина, CpG и RBD составляет: 26 мг: 40 мг: 1,2. мю.г: (3-6) мк г.

Предпочтительно, температура реакции составляет 20-28 ℃. Например, используется комнатная температура.

В предпочтительном варианте осуществления настоящего изобретения вакцина GO-Car-carnosine-CpG-RBD приготовлена следующим способом: GO соединяли с карнозином с помощью модификации реакции EDC-NHS, 26 мг лиофилизированного порошка GO добавляли к 5,20 мл фосфатного буфера (PBS, pH = 7,4) и сонировали (200 Вт, 40 кГц) при 25 ℃ в течение 3 ч.

Раствор GO активировали добавлением 6,82 мг EDC (N1- ((этилимино) метил-ен) -N3, N3-диметилпропан-1,3-диамин, китайский: 1- (3-диметиламинопропил) -3-этилкарбодиимид) и 7,73 мг NHS (N-N-гидроксисукцинимид) при 25 ℃.

Избыток EDC/sulfo-NHS был удален из реакционного раствора путем ультрафильтрации, после чего pH раствора был отрегулирован до 7,4. Затем в раствор добавляли 40 мг карнозина, 1,2 г CpG и различные концентрации рекомбинантного белка RBD и проводили реакцию с активированным GO при 25 ℃ в течение 2 ч. После этого избыток неконъюгированного белка удаляли из реакционного раствора ультрафильтрацией. Приготовленный продукт обозначен как GO-Car-carnosine-CpG-RBD вакцина.

Наконец, раствор вакцины GO-Car-carnosine-CpG-RBD контактировал со стерильным фильтром (0,22 мкм) и хранился в стерильных контейнерах при 4 ℃ для последующих экспериментов.

Изобретение создает техническую платформу для приготовления вакцины из нанорекомбинантного белка, способную быстро возбуждать иммунную систему человека и быстро производить большое количество профилактических вакцин после подтверждения наличия инфекционных вирусов.

Техническая платформа полностью использует свойство, что поверхность оксида графена снабжена COOH, гидроксильными и другими группами, и использует взаимодействие между пи-пи связями для сборки отсеянного рекомбинантного белка RBD, молекул CpG и карнозина вместе для приготовления нано вакцины рекомбинантного белка на основе оксида графена в качестве каркаса.

Вакцина может стимулировать организм к выработке высокотитражного нейтрализующего антитела RBD, направленного против SAR-CoV-2, и закладывает техническую основу для профилактики и лечения коронавирусной инфекции и будущих крупных вспышек подобных эпидемий.

В другом аспекте изобретение обеспечивает применение вакцины GO-Car-carnosine-CpG-RBD, а именно применение вакцины GO-Car-carnosine-CpG-RBD в приготовлении лекарства для профилактики нового коронавируса.

Предпочтительно, применение композиции может улучшить иммунитет организмов к новому коронавирусу.

Предпочтительно, вакцина GO-Car-carnosine-CpG-RBD может генерировать специфические антитела, нацеленные на RBD, и титр специфических антител является высоким. В варианте осуществления изобретения вакцина из нанонеокорона обладает более высокой иммуногенностью в мышином тесте и может генерировать антитела с высоким титром.

Изобретение обладает следующими преимуществами:

Разработана принципиально новая техническая платформа для вакцины, включающая каркасную молекулу CpG и рекомбинантный белок на основе оксида графена, в сочетании с рекомбинантным белком RBD области Spike белка SAR-CoV-2 для приготовления новой нано вакцины против коронавируса, в организме мыши может быть сгенерировано высокотитровое специфическое антитело, нацеленное на RBD, и обеспечена мощная поддержка для профилактики и лечения нового коронавируса.

Чертежи

Для более наглядной иллюстрации технических решений в вариантах осуществления настоящей заявки, ниже будут кратко описаны чертежи, необходимые для использования в вариантах осуществления, и очевидно, что чертежи в следующем описании являются лишь некоторыми вариантами осуществления настоящей заявки, и для специалистов в данной области очевидно получить другие чертежи без творческих усилий.

ФИГ. 1 - схематическая диаграмма и временная схема иммунизации мышей вакциной GO-Car-carnosine-CpG-RBD;

Рис. 1

На ФИГ. 2 показано изменение специфического антитела RBD в сыворотке крови через 28 дней после иммунизации мышей и изменение продукции цитокинов клетками селезенки через 42 дня после иммунизации мышей.

Рис. 2

 

Подробное описание

Технические решения в вариантах осуществления настоящей заявки будут ясно и полно описаны ниже, и следует понимать, что описанные варианты осуществления являются только частью вариантов осуществления настоящей заявки, а не всеми вариантами осуществления.

Все другие варианты осуществления, которые могут быть получены специалистом в данной области из приведенных здесь вариантов осуществления без приложения каких-либо творческих усилий, входят в объем защиты настоящей заявки. Методы и способы, не описанные конкретно, могут быть выполнены с использованием методов, известных в данной области техники. Например, обратитесь к справочнику по молекулярному клонированию компании Cold Spring Harbor.

Пример 1

Процесс приготовления вакцины из оксида графена (GO)-карнозин-CpG-RBD рекомбинантного белка

Выбор последовательности нуклеиновой кислоты рецептора TLR9 CpG ODN M362, которая имеет перекрестную реакцию как с человеком, так и с мышью, где специфическая последовательность выглядит следующим образом: 5 '-TCGTCGTCGTCGTTC: GAACGACGTTTGAT-3' (25 мер, SEQ ID NO 1), соединение GO с карнозином с помощью модификации реакции EDC-NHS, 26 мг лиофилизированного порошка GO добавляли к 5,20 мл фосфатного буфера (PBS, pH = 7,4) и сонировали (200 Вт, 40 кГц) при 25 ℃ в течение 3 ч.

Раствор GO активировали добавлением 6,82 мг EDC (N1- ((этилимино) метил-ен) -N3, N3-диметилпропан-1,3-диамин, китайский: 1- (3-диметиламинопропил) -3-этилкарбодиимид) и 7,73 мг NHS (N-N-гидроксисукцинимид) при 25 ℃.

Избыток EDC/sulfo-NHS был удален из реакционного раствора путем ультрафильтрации, после чего pH раствора был отрегулирован до 7,4. Затем в раствор добавляли 40 мг карнозина, 1,2 г CpG и различные концентрации рекомбинантного белка RBD и проводили реакцию с активированным GO при 25 ℃ в течение 2 ч. После этого избыток неконъюгированного белка удаляли из реакционного раствора ультрафильтрацией.

Приготовленный продукт обозначен как GO-Car-carnosine-CpG-RBD вакцина. Наконец, раствор вакцины GO-Car-carnosine-CpG-RBD контактировал со стерильным фильтром (0,22 мкм) и хранился в стерильных контейнерах при 4 ℃ для последующих экспериментов.

Пример 2

Испытание вакцины из оксида графена (GO) - карнозин-CpG-RBD рекомбинантного белка, которой иммунизированы мыши

6-недельных самок мышей BALB/c иммунизировали путем подкожной инъекции в 0, 14 и 28 дней, соответственно, в течение 28 дней и 42 дней в соответствии с графиком, показанным на ФИГ. 1, кровь собирали путем забора крови в , сыворотку отделяли и тестировали на наличие специфических антител против RBD.

Мышей приносили в жертву на 42 день, выделяли спленоциты и тестировали их на специфический Т-клеточный иммунный ответ и секрецию цитокинов.

Разделение на группы и определение дозы для иммунизированных мышей:

  1. (оксид графена + карнозин) + 1,2 г cpG +3 г RBD
  2. (оксид графена + карнозин) + 1.2ug cpG +6ug RBD
  3. Гидроксид алюминия +6ug RBD (1: 1)
  4. 6ug RBD
  5. Липосома (липо) +6ug RBD группа
  6. Штаммы мышей: BALB/c mic (n = 6).

График иммунизации мышей вакциной GO-Car-carnosine-CpG-RBD следующий: кровь была собрана и впервые иммунизирована в качестве отправной точки для иммунизации мышей.

И (5) сбор крови во второй раз на 7-й день и проверка новой системы добавления коронного вируса для освоения принципа. Сбор крови в третий раз на 14-й день и укрепление иммунитета.

Сбор крови в четвертый раз на 28-й день, укрепление иммунитета, выявление антител в сыворотке, и в случае положительного результата подготовка к сбору клеток селезенки. Пятый сбор крови на 42-й день, после чего приносили в жертву, выделяли спленоциты и проводили эксперименты с цитокинами.

Результаты испытаний показывают, что группы 3ug и 6ug вакцины GO-Car-carnosine-CpG-RBD генерируют высокотитражные специфические антитела к RBD после иммунизации мышей, и вакцина GO-Car-carnosine-CpG-RBD значительно отличается от группы с традиционным адъювантом, группы с RBD и группы с липосомами (рисунок 2).

Дальнейший анализ специфического иммунного ответа Т-клеток, выделенных из селезенки, показал, что вакцина GO-Car-carnosine-CpG-RBD может стимулировать организм к выработке специфических цитокинов IFN-gamma, улучшать иммунитет организма и противостоять эпидемической ситуации нового коронавируса.

Вышеприведенное описание относится только к конкретным вариантам осуществления настоящей заявки, но объем настоящей заявки не ограничен этим, и любые изменения или замены, которые могут быть легко придуманы специалистами в данной области техники в рамках технического объема настоящего раскрытия, должны быть охвачены объемом настоящей заявки. Таким образом, объем защиты настоящей заявки зависит от объема защиты формулы изобретения.